EIF1AY polyclonal antibody (A01)
  • EIF1AY polyclonal antibody (A01)

EIF1AY polyclonal antibody (A01)

Ref: AB-H00009086-A01
EIF1AY polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant EIF1AY.
Información adicional
Size 50 uL
Gene Name EIF1AY
Gene Alias -
Gene Description eukaryotic translation initiation factor 1A, Y-linked
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq DGQEYAQVIKMLGNGRLEAMCFDGVKRLCHIRGKLRKKVWINTSDIILVGLRDYQDNKADVILKYNADEARSLKAYGELPEHAKINETDT
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen EIF1AY (NP_004672, 31 a.a. ~ 120 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 9086

Enviar un mensaje


EIF1AY polyclonal antibody (A01)

EIF1AY polyclonal antibody (A01)