DIRAS3 monoclonal antibody (M01A), clone 1G4
  • DIRAS3 monoclonal antibody (M01A), clone 1G4

DIRAS3 monoclonal antibody (M01A), clone 1G4

Ref: AB-H00009077-M01A
DIRAS3 monoclonal antibody (M01A), clone 1G4

Información del producto

Mouse monoclonal antibody raised against a partial recombinant DIRAS3.
Información adicional
Size 200 uL
Gene Name DIRAS3
Gene Alias ARHI|NOEY2
Gene Description DIRAS family, GTP-binding RAS-like 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,ELISA
Immunogen Prot. Seq FYELICKIKGNNLHKFPIVLVGNKSDDTHREVALNDGATCAMEWNCAFMEISAKTDVNVQELFHMLLNYKKKPTTGLQEPEKKSQMPNTTEKLLDKCIIM
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen DIRAS3 (NP_004666, 130 a.a. ~ 229 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In ascites fluid
Gene ID 9077
Clone Number 1G4
Iso type IgM kappa

Enviar un mensaje


DIRAS3 monoclonal antibody (M01A), clone 1G4

DIRAS3 monoclonal antibody (M01A), clone 1G4