DIRAS3 polyclonal antibody (A01)
  • DIRAS3 polyclonal antibody (A01)

DIRAS3 polyclonal antibody (A01)

Ref: AB-H00009077-A01
DIRAS3 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant DIRAS3.
Información adicional
Size 50 uL
Gene Name DIRAS3
Gene Alias ARHI|NOEY2
Gene Description DIRAS family, GTP-binding RAS-like 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq FYELICKIKGNNLHKFPIVLVGNKSDDTHREVALNDGATCAMEWNCAFMEISAKTDVNVQELFHMLLNYKKKPTTGLQEPEKKSQMPNTTEKLLDKCIIM
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen DIRAS3 (NP_004666, 130 a.a. ~ 229 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 9077

Enviar un mensaje


DIRAS3 polyclonal antibody (A01)

DIRAS3 polyclonal antibody (A01)