CLDN6 monoclonal antibody (M01), clone 1P8
  • CLDN6 monoclonal antibody (M01), clone 1P8

CLDN6 monoclonal antibody (M01), clone 1P8

Ref: AB-H00009074-M01
CLDN6 monoclonal antibody (M01), clone 1P8

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant CLDN6.
Información adicional
Size 100 ug
Gene Name CLDN6
Gene Alias -
Gene Description claudin 6
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq MASAGMQILGVVLTLLGWVNGLVSCALPMWKVTAFIGNSIVVAQVVWEGLWMSCVVQSTGQMQCKVYDSLLALPQDLQAARALCVIALLVALFGLLVYLAGAKCTTCVEEKDSKARLVLTSGIVFVISGVLTLIPVCWTAHAVIRDFYNPLVAEAQKRELGASLYLGWAASGLLLLGGGLLCCTCPSGGSQGPSHYMARYSTSAPAISRGPSEYPTKNYV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CLDN6 (NP_067018.1, 1 a.a. ~ 220 a.a) full-length recombinant protein with GST tag.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9074
Clone Number 1P8
Iso type IgG2b Kappa

Enviar un mensaje


CLDN6 monoclonal antibody (M01), clone 1P8

CLDN6 monoclonal antibody (M01), clone 1P8