SLC13A2 polyclonal antibody (A01)
  • SLC13A2 polyclonal antibody (A01)

SLC13A2 polyclonal antibody (A01)

Ref: AB-H00009058-A01
SLC13A2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant SLC13A2.
Información adicional
Size 50 uL
Gene Name SLC13A2
Gene Alias NADC1|NaDC-1
Gene Description solute carrier family 13 (sodium-dependent dicarboxylate transporter), member 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq AMMVPIAHAVLDQLHSSQASSNVEEGSNNPTFELQEPSPQKEVTKLDNGQALPVTSASSEGRAHLSQKHLHLTQC
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SLC13A2 (NP_003975, 146 a.a. ~ 220 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 9058

Enviar un mensaje


SLC13A2 polyclonal antibody (A01)

SLC13A2 polyclonal antibody (A01)