RPL14 monoclonal antibody (M01), clone 1B4
  • RPL14 monoclonal antibody (M01), clone 1B4

RPL14 monoclonal antibody (M01), clone 1B4

Ref: AB-H00009045-M01
RPL14 monoclonal antibody (M01), clone 1B4

Información del producto

Mouse monoclonal antibody raised against a partial recombinant RPL14.
Información adicional
Size 100 ug
Gene Name RPL14
Gene Alias CAG-ISL-7|CTG-B33|L14|MGC88594|RL14|hRL14
Gene Description ribosomal protein L14
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,IHC-P,S-ELISA,ELISA
Immunogen Prot. Seq MVFRRFVEVGRVAYVSFGPHAGKLVAIVDVIDQNRALVDGPCTQVRRQAMPFKCMQLTDFILKFPHSAHQKYVRQAWQKADINTKWAATR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RPL14 (NP_003964, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9045
Clone Number 1B4
Iso type IgG2a Kappa

Enviar un mensaje


RPL14 monoclonal antibody (M01), clone 1B4

RPL14 monoclonal antibody (M01), clone 1B4