UBE2M monoclonal antibody (M02), clone 1G9
  • UBE2M monoclonal antibody (M02), clone 1G9

UBE2M monoclonal antibody (M02), clone 1G9

Ref: AB-H00009040-M02
UBE2M monoclonal antibody (M02), clone 1G9

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant UBE2M.
Información adicional
Size 100 ug
Gene Name UBE2M
Gene Alias UBC-RS2|UBC12|hUbc12
Gene Description ubiquitin-conjugating enzyme E2M (UBC12 homolog, yeast)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MIKLFSLKQQKKEEESAGGTKGSSKKASAAQLRIQKDINELNLPKTCDISFSDPDDLLNFKLVICPDEGFYKSGKFVFSFKVGQGYPHDPPKVKCETMVYHPNIDLEGNVCLNILREDWKPVLTINSIIYGLQYLFLEPNPEDPLNKEAAEVLQNNRRLFEQNVQRSMRGGYIGSTYFERCLK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen UBE2M (AAH58924, 1 a.a. ~ 183 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9040
Clone Number 1G9
Iso type IgG1 Kappa

Enviar un mensaje


UBE2M monoclonal antibody (M02), clone 1G9

UBE2M monoclonal antibody (M02), clone 1G9