HIP1R monoclonal antibody (M01A), clone 3E10
  • HIP1R monoclonal antibody (M01A), clone 3E10

HIP1R monoclonal antibody (M01A), clone 3E10

Ref: AB-H00009026-M01A
HIP1R monoclonal antibody (M01A), clone 3E10

Información del producto

Mouse monoclonal antibody raised against a partial recombinant HIP1R.
Información adicional
Size 200 uL
Gene Name HIP1R
Gene Alias FLJ14000|FLJ27022|HIP12|HIP3|ILWEQ|KIAA0655|MGC47513
Gene Description huntingtin interacting protein 1 related
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq SGLSLIKLKKQEMETQVRVLELEKTLEAERMRLGELRKQHYVLAGASGSPGEEVAIRPSTAPRSVTTKKPPLAQKPSVAPRQDHQLDKKDGIYPAQLV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen HIP1R (NP_003950, 969 a.a. ~ 1066 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In ascites fluid
Gene ID 9026
Clone Number 3E10
Iso type IgG1 Kappa

Enviar un mensaje


HIP1R monoclonal antibody (M01A), clone 3E10

HIP1R monoclonal antibody (M01A), clone 3E10