RNF8 purified MaxPab mouse polyclonal antibody (B01P)
  • RNF8 purified MaxPab mouse polyclonal antibody (B01P)

RNF8 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00009025-B01P
RNF8 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human RNF8 protein.
Información adicional
Size 50 ug
Gene Name RNF8
Gene Alias FLJ12013|KIAA0646
Gene Description ring finger protein 8
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MGEPGFFVTGDRAGGRSWCLRRVGMSAGWLLLEDGCEVTVGRGFGVTYQLVSKICPLMISRNHCVLKQNPEGQWTIMDNKSLNGVWLNRARLEPLRVYSIHQGDYIQLGVPLENKENAEYEYEVTEEDWETIYPCLSPKNDQMIEKNKELRTKRKFSLDELAGPGAEGPSNLKSKINKVSCESGQPVKSQGKGEVASTPSDNLDPKLTALEPSKTTGAPIYPGFPKVTEVHHEQKASNSSASQRSLQMFKVTMSR
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen RNF8 (NP_003949.1, 1 a.a. ~ 485 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9025

Enviar un mensaje


RNF8 purified MaxPab mouse polyclonal antibody (B01P)

RNF8 purified MaxPab mouse polyclonal antibody (B01P)