CLIC3 monoclonal antibody (M04), clone 2C5
  • CLIC3 monoclonal antibody (M04), clone 2C5

CLIC3 monoclonal antibody (M04), clone 2C5

Ref: AB-H00009022-M04
CLIC3 monoclonal antibody (M04), clone 2C5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CLIC3.
Información adicional
Size 100 ug
Gene Name CLIC3
Gene Alias -
Gene Description chloride intracellular channel 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq RLDSYLRAPLEHELAGEPQLRESRRRFLDGDRLTLADCSLLPKLHIVDTVCAHFRQAPIPAELRGVRRYLDSAMQEKEFKYTCPHSAEILAAYRPAVHPR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CLIC3 (NP_004660, 137 a.a. ~ 236 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9022
Clone Number 2C5
Iso type IgG1 Kappa

Enviar un mensaje


CLIC3 monoclonal antibody (M04), clone 2C5

CLIC3 monoclonal antibody (M04), clone 2C5