MPZL1 MaxPab rabbit polyclonal antibody (D01)
  • MPZL1 MaxPab rabbit polyclonal antibody (D01)

MPZL1 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00009019-D01
MPZL1 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human MPZL1 protein.
Información adicional
Size 100 uL
Gene Name MPZL1
Gene Alias FLJ21047|PZR|PZR1b|PZRa|PZRb
Gene Description myelin protein zero-like 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IP,IF
Immunogen Prot. Seq MAASAGAGAVIAAPDSRRWLWSVLAAALGLLTAGVSALEVYTPKEIFVANGTQGKLTCKFKSTSTTGGLTSVSWSFQPEGADTTVSFFHYSQGQVYLGNYPPFKDRISWAGDLDKKDASINIENMQFIHNGTYICDVKNPPDIVVQPGHIRLYVVEKENLPVFPVWVVVGIVTAVVLGLTLLISMILAVLYRRKNSKRDYTGCSTSESLSPVKQAPRKSPSDTEGLVKSLPSGSHQGPVIYAQLDHSGGHHSDKI
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen MPZL1 (NP_003944.1, 1 a.a. ~ 269 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 9019

Enviar un mensaje


MPZL1 MaxPab rabbit polyclonal antibody (D01)

MPZL1 MaxPab rabbit polyclonal antibody (D01)