MPZL1 polyclonal antibody (A01)
  • MPZL1 polyclonal antibody (A01)

MPZL1 polyclonal antibody (A01)

Ref: AB-H00009019-A01
MPZL1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant MPZL1.
Información adicional
Size 50 uL
Gene Name MPZL1
Gene Alias FLJ21047|PZR|PZR1b|PZRa|PZRb
Gene Description myelin protein zero-like 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MAASAGAGAVIAAPDSRRWLWSVLAAALGLLTAGVSALEVYTPKEIFVANGTQGKLTCKFKSTSTTGGLTSVSWSFQPEGADTTVSFFHYSQGQVYLGNYPPFKDRISWAGDLDKKDASINIENMQFIHNGTYICDVKNPPDIVVQPGHIRLYVVEKENLPVFPVWVVVGIVTAVVLGLTLLISMILAVLYRRKNSKRDYTGCSTSESLSPVKQAPRKSPSDTEGLVKSLPSGSHQGPVIYAQLDHSGGHHSDKI
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MPZL1 (AAH07881, 1 a.a. ~ 269 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 9019

Enviar un mensaje


MPZL1 polyclonal antibody (A01)

MPZL1 polyclonal antibody (A01)