TRPA1 purified MaxPab rabbit polyclonal antibody (D01P)
  • TRPA1 purified MaxPab rabbit polyclonal antibody (D01P)

TRPA1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00008989-D01P
TRPA1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human TRPA1 protein.
Información adicional
Size 100 ug
Gene Name TRPA1
Gene Alias ANKTM1
Gene Description transient receptor potential cation channel, subfamily A, member 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MKRSLRKMWRPGEKKEPQGVVYEDVPDDTEDFKESLKVVFEGSAYGLQNFNKQKKLKRCDDMDTFFLHYAAAEGQIELMEKITRDSSLEVLHEMDDYGNTPLHCAVEKNQIESVKFLLSRGANPNLRNFNMMAPLHIAVQGMNNEVMKVLLEHRTIDVNLEGENGNTAVIIACTTNNSEALQILLKKGAKPCKSNKWGCFPIHQAAFSGSKECMEIILRFGEEHGYSRQLHINFMNNGKATPLHLAVQNGDLEMI
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TRPA1 (AAI53004.1, 1 a.a. ~ 1119 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8989

Enviar un mensaje


TRPA1 purified MaxPab rabbit polyclonal antibody (D01P)

TRPA1 purified MaxPab rabbit polyclonal antibody (D01P)