TRPA1 polyclonal antibody (A01)
  • TRPA1 polyclonal antibody (A01)

TRPA1 polyclonal antibody (A01)

Ref: AB-H00008989-A01
TRPA1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant TRPA1.
Información adicional
Size 50 uL
Gene Name TRPA1
Gene Alias ANKTM1
Gene Description transient receptor potential cation channel, subfamily A, member 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq IPNADKSLEMEILKQKYRLKDLTFLLEKQHELIKLIIQKMEIISETEDDDSHCSFQDRFKKEQMEQRNSRWNTVLRAVKAKTHHL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TRPA1 (NP_015628, 1033 a.a. ~ 1117 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 8989

Enviar un mensaje


TRPA1 polyclonal antibody (A01)

TRPA1 polyclonal antibody (A01)