PLOD3 polyclonal antibody (A01)
  • PLOD3 polyclonal antibody (A01)

PLOD3 polyclonal antibody (A01)

Ref: AB-H00008985-A01
PLOD3 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant PLOD3.
Información adicional
Size 50 uL
Gene Name PLOD3
Gene Alias LH3
Gene Description procollagen-lysine, 2-oxoglutarate 5-dioxygenase 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq MTSSGPGPRFLLLLPLLLPPAASASDRPRGRDPVNPEKLLVITVATAETEGYLRFLRSAEFFNYTVRTLGLGEEWRGGDVARTVGGGQKVRWLKKEMEKYADREDMIIMFVDSYDVILAGSPTELLKKFVQSGSRLLFSAESFCWPEWGLAEQYPEVGTGKRFLNSGGFIGFATTIHQIVRQWKYKDDDDDQLFYTRLYLDPGLREKLSLNLDHKSRIFQNLNGALDEVVLKFDRNRVRIRNVAYDTLPIVVHGN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PLOD3 (AAH11674.1, 1 a.a. ~ 738 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 8985

Enviar un mensaje


PLOD3 polyclonal antibody (A01)

PLOD3 polyclonal antibody (A01)