KYNU monoclonal antibody (M02), clone 1G2
  • KYNU monoclonal antibody (M02), clone 1G2

KYNU monoclonal antibody (M02), clone 1G2

Ref: AB-H00008942-M02
KYNU monoclonal antibody (M02), clone 1G2

Información del producto

Mouse monoclonal antibody raised against a partial recombinant KYNU.
Información adicional
Size 100 ug
Gene Name KYNU
Gene Alias -
Gene Description kynureninase (L-kynurenine hydrolase)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq EPSSLELPADTVQRIAAELKCHPTDERVALHLDEEDKLRHFRECFYIPKIQDLPPVDLSLVNKDENAIYFLGNSLGLQPKMVKTYLEEELDKWAKIAAYGHEVGKRP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen KYNU (NP_003928, 2 a.a. ~ 108 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8942
Clone Number 1G2
Iso type IgG2a Lambda

Enviar un mensaje


KYNU monoclonal antibody (M02), clone 1G2

KYNU monoclonal antibody (M02), clone 1G2