CDK5R2 purified MaxPab mouse polyclonal antibody (B01P)
  • CDK5R2 purified MaxPab mouse polyclonal antibody (B01P)

CDK5R2 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00008941-B01P
CDK5R2 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human CDK5R2 protein.
Información adicional
Size 50 ug
Gene Name CDK5R2
Gene Alias NCK5AI|P39|p39nck5ai
Gene Description cyclin-dependent kinase 5, regulatory subunit 2 (p39)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MGTVLSLSPASSAKGRRPGGLPEEKKKAPPAGDEALGGYGAPPVGKGGKGESRLKRPSVLISALTWRRLVAASAKKKKGSKKVTPKPASTGPDPLVQQRNRENLLRKGRDPPDGGGTAKPLAVPVPTVPAAAATCEPPSGGSAAAQPPGSGGGKPPPPPPPAPQVAPPVPGGSPRRVIVQASTGELLRCLGDFVCRRCYRLKELSPGELVGWFRGVDRSLLLQGWQDQAFITPANLVFVYLLCRESLRGDELASA
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CDK5R2 (AAH41771.1, 1 a.a. ~ 367 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8941

Enviar un mensaje


CDK5R2 purified MaxPab mouse polyclonal antibody (B01P)

CDK5R2 purified MaxPab mouse polyclonal antibody (B01P)