RAB7L1 monoclonal antibody (M03), clone 2B8
  • RAB7L1 monoclonal antibody (M03), clone 2B8

RAB7L1 monoclonal antibody (M03), clone 2B8

Ref: AB-H00008934-M03
RAB7L1 monoclonal antibody (M03), clone 2B8

Información del producto

Mouse monoclonal antibody raised against a full length recombinant RAB7L1.
Información adicional
Size 100 ug
Gene Name RAB7L1
Gene Alias DKFZp686P1051|RAB7L
Gene Description RAB7, member RAS oncogene family-like 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,WB-Re,S-ELISA,ELISA,RNAi-Ab
Immunogen Prot. Seq MGSRDHLFKVLVVGDAAVGKTSLVQRYSQDSFSKHYKSTVGVDFALKVLQWSDYEIVRLQLWDIAGQERFTSMTRLYYRDASACVIMFDVTNATTFSNSQRWKQDLDSKLTLPNGEPVPCLLLANKCDLSPWAVSRDQIDRFSKENGFTGWTETSVKENKNINEAMRVLIEKMMRNSTEDIMSLSTQGDYINLQTKSSSWSCC
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RAB7L1 (AAH02585, 1 a.a. ~ 203 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8934
Clone Number 2B8
Iso type IgG2b Kappa

Enviar un mensaje


RAB7L1 monoclonal antibody (M03), clone 2B8

RAB7L1 monoclonal antibody (M03), clone 2B8