CXX1 purified MaxPab mouse polyclonal antibody (B01P)
  • CXX1 purified MaxPab mouse polyclonal antibody (B01P)

CXX1 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00008933-B01P
CXX1 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human CXX1 protein.
Información adicional
Size 50 ug
Gene Name FAM127A
Gene Alias CXX1|MAR8C|MART8C|MGC117411|Mar8|Mart8
Gene Description family with sequence similarity 127, member A
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MGGGRGLLGRETLGPGGGCSGEGPLCYWPPPGSPPAPSLRASLPLEPPRCPLRSCSLPRSACLCSRNSAPGSCCRPWASLWSEPPPSPSSQPAPPMYIWTLSCAPAASWAPVTHWTDHPLPPLPSPLLPTRLPDDYIILPTDLRCHSHRHPSHPTDRLLLLVIWTHLGGIWAGHSPWTVIQTAGRPPRDLSPSARPISSPPPETSCVLA
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CXX1 (AAH02410, 1 a.a. ~ 209 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8933

Enviar un mensaje


CXX1 purified MaxPab mouse polyclonal antibody (B01P)

CXX1 purified MaxPab mouse polyclonal antibody (B01P)