FOXH1 purified MaxPab rabbit polyclonal antibody (D01P)
  • FOXH1 purified MaxPab rabbit polyclonal antibody (D01P)

FOXH1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00008928-D01P
FOXH1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human FOXH1 protein.
Información adicional
Size 100 ug
Gene Name FOXH1
Gene Alias FAST-1|FAST1
Gene Description forkhead box H1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MGPCSGSRLGPPEAESPSQPPKRRKKRYLRHDKPPYTYLAMIALVIQAAPSRRLKLAQIIRQVQAVFPFFREDYEGWKDSIRHNLSSNRCFRKVPKDPAKPQAKGNFWAVDVSLIPAEALRLQNTALCRRWQNGGARGAFAKDLGPYVLHGRPYRPPSPPPPPSEGFSIKSLLGGSGEGAPWPGLAPQSSPVPAGTGNSGEEAVPTPPLPSSERPLWPLCPLPGPTRVEGETVQGGAIGPSTLSPEPRAWPLHLL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen FOXH1 (AAI11605.1, 1 a.a. ~ 365 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8928

Enviar un mensaje


FOXH1 purified MaxPab rabbit polyclonal antibody (D01P)

FOXH1 purified MaxPab rabbit polyclonal antibody (D01P)