GYG2 purified MaxPab mouse polyclonal antibody (B01P)
  • GYG2 purified MaxPab mouse polyclonal antibody (B01P)

GYG2 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00008908-B01P
GYG2 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human GYG2 protein.
Información adicional
Size 50 ug
Gene Name GYG2
Gene Alias GN-2|GN2
Gene Description glycogenin 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MSVTDQAFVTLATNDIYCQGALVLGQSLRRHRLTRKLVVLITPQVSSLLRVILSKVFDEVIEVNLIDSADYIHLAFLKRPELGLTLTKLHCWTLTHYSKCVFLDADTLVLSNVDELFDRGEFSAAPDPGWPDCFNSGVFVFQPSLHTHKLLLQHAMEHGSFDGADQGLLNSFFRNWSTTDIHKHLPFIYNLSSNTMYTYSPAFKQFGSSAKVVHFLGSMKPWNYKYNPQSGSVLEQGSVSSSQHQAAFLHLWWTV
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen GYG2 (AAH23152.1, 1 a.a. ~ 470 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8908

Enviar un mensaje


GYG2 purified MaxPab mouse polyclonal antibody (B01P)

GYG2 purified MaxPab mouse polyclonal antibody (B01P)