CPNE1 monoclonal antibody (M01), clone 8B8
  • CPNE1 monoclonal antibody (M01), clone 8B8

CPNE1 monoclonal antibody (M01), clone 8B8

Ref: AB-H00008904-M01
CPNE1 monoclonal antibody (M01), clone 8B8

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CPNE1.
Información adicional
Size 100 ug
Gene Name CPNE1
Gene Alias COPN1|CPN1|MGC1142
Gene Description copine I
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,WB-Re,S-ELISA,ELISA,RNAi-Ab
Immunogen Prot. Seq TLPLMLKPGKPAGRGTITVSAQELKDNRVVTMEVEARNLDKKDFLGKSDPFLEFFRQGDGKWHLVYRSEVIKNNLNPTWKRFSVPVQHFCGGNPSTPIQV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CPNE1 (NP_003906, 111 a.a. ~ 210 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8904
Clone Number 8B8
Iso type IgG2a Kappa

Enviar un mensaje


CPNE1 monoclonal antibody (M01), clone 8B8

CPNE1 monoclonal antibody (M01), clone 8B8