CCNA1 monoclonal antibody (M02), clone 4A11-5B5
  • CCNA1 monoclonal antibody (M02), clone 4A11-5B5

CCNA1 monoclonal antibody (M02), clone 4A11-5B5

Ref: AB-H00008900-M02
CCNA1 monoclonal antibody (M02), clone 4A11-5B5

Información del producto

Mouse monoclonal antibody raised against a full length recombinant CCNA1.
Información adicional
Size 100 ug
Gene Name CCNA1
Gene Alias -
Gene Description cyclin A1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA,PLA-Ce
Immunogen Prot. Seq METGFPAIMYPGSFIGGWGEEYLSWEGPGLPDFVFQQPVESEAMHCSNPKSGVVLATVARGPDACQILTRAPLGQDPPQRTVLGLLTANGQYRRTCGQGITRIRCYSGSENAFPPAGKKALPDCGVQEPPKQGFDIYMDELEQGDRDSCSVREGMAFEDVYEVDTGTLKSDLHFLLDFNTVSPMLVDSSLLSQSEDISSLGTDVINVTEYAEEIYQYLREAEIRHRPKAHYMKKQPDITEGMRTILVDWLVEVGE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CCNA1 (AAH36346, 1 a.a. ~ 464 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8900
Clone Number 4A11-5B5
Iso type IgG1 Kappa

Enviar un mensaje


CCNA1 monoclonal antibody (M02), clone 4A11-5B5

CCNA1 monoclonal antibody (M02), clone 4A11-5B5