CCNA1 purified MaxPab mouse polyclonal antibody (B01P)
  • CCNA1 purified MaxPab mouse polyclonal antibody (B01P)

CCNA1 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00008900-B01P
CCNA1 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human CCNA1 protein.
Información adicional
Size 50 ug
Gene Name CCNA1
Gene Alias -
Gene Description cyclin A1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq METGFPAIMYPGSFIGGWGEEYLSWEGPGLPDFVFQQPVESEAMHCSNPKSGVVLATVARGPDACQILTRAPLGQDPPQRTVLGLLTANGQYRRTCGQGITRIRCYSGSENAFPPAGKKALPDCGVQEPPKQGFDIYMDELEQGDRDSCSVREGMAFEDVYEVDTGTLKSDLHFLLDFNTVSPMLVDSSLLSQSEDISSLGTDVINVTEYAEEIYQYLREAEIRHRPKAHYMKKQPDITEGMRTILVDWLVEVGE
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CCNA1 (ABM85414.1, 1 a.a. ~ 464 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8900

Enviar un mensaje


CCNA1 purified MaxPab mouse polyclonal antibody (B01P)

CCNA1 purified MaxPab mouse polyclonal antibody (B01P)