CCNA1 polyclonal antibody (A01)
  • CCNA1 polyclonal antibody (A01)

CCNA1 polyclonal antibody (A01)

Ref: AB-H00008900-A01
CCNA1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant CCNA1.
Información adicional
Size 50 uL
Gene Name CCNA1
Gene Alias -
Gene Description cyclin A1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq METGFPAIMYPGSFIGGWGEEYLSWEGPGLPDFVFQQPVESEAMHCSNPKSGVVLATVARGPDACQILTRAPLGQDPPQRTVLGLLTANGQYRRTCGQGITRIRCYSGSENAFPPAGKKALPDCGVQEPPKQGFDIYMDELEQGDRDSCSVREGMAFEDVYEVDTGTLKSDLHFLLDFNTVSPMLVDSSLLSQSEDISSLGTDVINVTEYAEEIYQYLREAEIRHRPKAHYMKKQPDITEGMRTILVDWLVEVGE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CCNA1 (AAH36346, 1 a.a. ~ 464 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 8900

Enviar un mensaje


CCNA1 polyclonal antibody (A01)

CCNA1 polyclonal antibody (A01)