EIF2B5 polyclonal antibody (A01)
  • EIF2B5 polyclonal antibody (A01)

EIF2B5 polyclonal antibody (A01)

Ref: AB-H00008893-A01
EIF2B5 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant EIF2B5.
Información adicional
Size 50 uL
Gene Name EIF2B5
Gene Alias CACH|CLE|EIF-2B|EIF2Bepsilon|LVWM
Gene Description eukaryotic translation initiation factor 2B, subunit 5 epsilon, 82kDa
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq LPLLKAWSPVFRNYIKRAADHLEALAAIEDFFLEHEALGISMAKVLMAFYQLEILAEETILSWFSQRDTTDKGQQLRKNQQLQRFIQWLKEAEEESSED
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen EIF2B5 (NP_003898, 622 a.a. ~ 720 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 8893

Enviar un mensaje


EIF2B5 polyclonal antibody (A01)

EIF2B5 polyclonal antibody (A01)