EIF2B3 purified MaxPab mouse polyclonal antibody (B01P)
  • EIF2B3 purified MaxPab mouse polyclonal antibody (B01P)

EIF2B3 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00008891-B01P
EIF2B3 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human EIF2B3 protein.
Información adicional
Size 50 ug
Gene Name EIF2B3
Gene Alias EIF-2B|EIF2Bgamma
Gene Description eukaryotic translation initiation factor 2B, subunit 3 gamma, 58kDa
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MEFQAVVMAVGGGSRMTDLTSSIPKPLLPVGNKPLIWYPLNLLERVGFEEVIVVTTRDVQKALCAEFKMKMKPDIVCIPDDADMGTADSLRYIYPKLKTDVLVLSCDLITDVALHEVVDLFRAYDASLAMLMRKGQDSIEPVPGQKGKKKAVEQRDFIGVDSTGKRLLFMANEADLDEELVIKGSILQKHPRIRFHTGLVDAHLYCLKKYIVDFLMENGSITSIRSELIPYLVRKQFSSASSQQGQEEKEEDLKK
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen EIF2B3 (NP_065098.1, 1 a.a. ~ 452 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8891

Enviar un mensaje


EIF2B3 purified MaxPab mouse polyclonal antibody (B01P)

EIF2B3 purified MaxPab mouse polyclonal antibody (B01P)