ZNF259 purified MaxPab rabbit polyclonal antibody (D01P)
  • ZNF259 purified MaxPab rabbit polyclonal antibody (D01P)

ZNF259 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00008882-D01P
ZNF259 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human ZNF259 protein.
Información adicional
Size 100 ug
Gene Name ZNF259
Gene Alias MGC110983|ZPR1
Gene Description zinc finger protein 259
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MAASGAVEPGPPGAAVAPSPAPAPPPAPDHLFRPISAEDEEQQPTEIESLCMNCYCNGMTRLLLTKIPFFREIIVSSFSCEHCGWNNTEIQSAGRIQDQGVRYTLSVRALEDMNREVVKTDSAATRIPELDFEIPAFSQKGALTTVEGLITRAISGLEQDQPARRANKDATAERIDEFIVKLKELKQVASPFTLIIDDPSGNSFVENPHAPQKDDALVITHYNRTRQQEEMLGLQEEAPAEKPEEEDLRNEVLQF
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ZNF259 (NP_003895.1, 1 a.a. ~ 459 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8882

Enviar un mensaje


ZNF259 purified MaxPab rabbit polyclonal antibody (D01P)

ZNF259 purified MaxPab rabbit polyclonal antibody (D01P)