ARHGEF7 purified MaxPab rabbit polyclonal antibody (D01P)
  • ARHGEF7 purified MaxPab rabbit polyclonal antibody (D01P)

ARHGEF7 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00008874-D01P
ARHGEF7 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human ARHGEF7 protein.
Información adicional
Size 100 ug
Gene Name ARHGEF7
Gene Alias BETA-PIX|COOL1|DKFZp686C12170|DKFZp761K1021|KIAA0142|KIAA0412|Nbla10314|P50|P50BP|P85|P85COOL1|P85SPR|PAK3|PIXB
Gene Description Rho guanine nucleotide exchange factor (GEF) 7
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MTDNSNNQLVVRAKFNFQQTNEDELSFSKGDVIHVTRVEEGGWWEGTLNGRTGWFPSNYVREVKASEKPVSPKSGTLKSPPKGFDTTAINKSYYNVVLQNILETENEYSKELQTVLSTYLRPLQTSEKLSSANISYLMGNLEEICSFQQMLVQSLEECTKLPEAQQRVGGCFLNLMPQMKTLYLTYCANHPSAVNVLTEHSEELGEFMETKGASSPGILVLTTGLSKPFMRLDKYPTLLKELERHMEDYHTDRQD
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ARHGEF7 (NP_003890.1, 1 a.a. ~ 646 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8874

Enviar un mensaje


ARHGEF7 purified MaxPab rabbit polyclonal antibody (D01P)

ARHGEF7 purified MaxPab rabbit polyclonal antibody (D01P)