ARHGEF7 polyclonal antibody (A01)
  • ARHGEF7 polyclonal antibody (A01)

ARHGEF7 polyclonal antibody (A01)

Ref: AB-H00008874-A01
ARHGEF7 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant ARHGEF7.
Información adicional
Size 50 uL
Gene Name ARHGEF7
Gene Alias BETA-PIX|COOL1|DKFZp686C12170|DKFZp761K1021|KIAA0142|KIAA0412|Nbla10314|P50|P50BP|P85|P85COOL1|P85SPR|PAK3|PIXB
Gene Description Rho guanine nucleotide exchange factor (GEF) 7
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq SSLVTLNKVTADIGLGSDSVCARPSSHRIKSFDSLGSQSLHTRTSKLFQGQYRSLDMTDNSNNQLVVRAKFNFQQTNEDELSFSKGDVI
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ARHGEF7 (NP_663788, 102 a.a. ~ 190 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 8874

Enviar un mensaje


ARHGEF7 polyclonal antibody (A01)

ARHGEF7 polyclonal antibody (A01)