Ver mas grande
SYNJ2 monoclonal antibody (M03), clone 2B11
AB-H00008871-M03
Producto nuevo
SYNJ2 monoclonal antibody (M03), clone 2B11
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 100 ug |
| Gene Name | SYNJ2 |
| Gene Alias | INPP5H|KIAA0348|MGC44422 |
| Gene Description | synaptojanin 2 |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Re,ELISA |
| Immunogen Prot. Seq | GTKAMKPEAAPLLGDYQDPFWNLLHHPKLLNNTWLSKSSDPLDSGTRSPKRDPIDPVSAGASAAKAELPPDHEHKTLGHWVTISDQEKRTALQVFDPLAK |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | SYNJ2 (NP_003889, 1396 a.a. ~ 1495 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Storage Buffer | In 1x PBS, pH 7.4 |
| Gene ID | 8871 |
| Clone Number | 2B11 |
| Iso type | IgG3 Kappa |
Más información
Mouse monoclonal antibody raised against a partial recombinant SYNJ2.