PER2 monoclonal antibody (M03), clone 5E6
  • PER2 monoclonal antibody (M03), clone 5E6

PER2 monoclonal antibody (M03), clone 5E6

Ref: AB-H00008864-M03
PER2 monoclonal antibody (M03), clone 5E6

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PER2.
Información adicional
Size 100 ug
Gene Name PER2
Gene Alias FASPS|KIAA0347
Gene Description period homolog 2 (Drosophila)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq MNGYAEFPPSPSNPTKEPVEPQPSQVPLQEDVDMSSGSSGHETNENCSTGRDSQGSDCDDSGKELGMLVEPPDARQSPDTFSLMMAKSEHNPSTSGCSSD
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PER2 (NP_073728, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8864
Clone Number 5E6
Iso type IgG2b Kappa

Enviar un mensaje


PER2 monoclonal antibody (M03), clone 5E6

PER2 monoclonal antibody (M03), clone 5E6