APLN monoclonal antibody (M02), clone 1A8-2A5
  • APLN monoclonal antibody (M02), clone 1A8-2A5

APLN monoclonal antibody (M02), clone 1A8-2A5

Ref: AB-H00008862-M02
APLN monoclonal antibody (M02), clone 1A8-2A5

Información del producto

Mouse monoclonal antibody raised against a full length recombinant APLN.
Información adicional
Size 100 ug
Gene Name APLN
Gene Alias XNPEP2
Gene Description apelin
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MSATWCSPEGQGMGQGPGREVGGNSAASGPASPIRDPCLSEAGLKGPPSAHPRRLCLLHRLVCFSGGLTSIQLSPRTCCSHQWAQLFSPACFPQWRAPGCSLDDSRSLTRIRPVHLPGPSLD
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen APLN (AAH21104.1, 1 a.a. ~ 122 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8862
Clone Number 1A8-2A5
Iso type IgG1 Kappa

Enviar un mensaje


APLN monoclonal antibody (M02), clone 1A8-2A5

APLN monoclonal antibody (M02), clone 1A8-2A5