Ver mas grande
STK19 MaxPab rabbit polyclonal antibody (D01)
AB-H00008859-D01
Producto nuevo
STK19 MaxPab rabbit polyclonal antibody (D01)
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 100 uL |
| Gene Name | STK19 |
| Gene Alias | D6S60|D6S60E|G11|HLA-RP1|MGC117388|RP1 |
| Gene Description | serine/threonine kinase 19 |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Tr,IP |
| Immunogen Prot. Seq | MQKWFSAFDDAIIQRQWRANPSRGGGGVSFTKEVDTNVATGAPPRRQRVPGRACPWREPIRGRRGARPGGGDAGGTPGETVRHCSAPEDPIFRFSSLHSYPFPGTIKSRDMSWKRHHLIPETFGVKRRRKRGPVESDPLRGEPGSARAAVSELMQLFPRGLFEDALPPIVLRSQVYSLVPDRTVADRQLKELQEQGEIRIVQLGFDLDAHGIIFTEDYRTRVLKACDGRPYAGAVQKFLASVLPACGDLSFQQDQ |
| Antigen species Target species | Human |
| Quality control testing | Antibody reactive against mammalian transfected lysate. |
| Immunogen | STK19 (NP_004188.1, 1 a.a. ~ 364 a.a) full-length human protein. |
| Storage Buffer | No additive |
| Gene ID | 8859 |
Más información
Rabbit polyclonal antibody raised against a full-length human STK19 protein.