DDEF2 polyclonal antibody (A01)
  • DDEF2 polyclonal antibody (A01)

DDEF2 polyclonal antibody (A01)

Ref: AB-H00008853-A01
DDEF2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant DDEF2.
Información adicional
Size 50 uL
Gene Name ASAP2
Gene Alias AMAP2|CENTB3|DDEF2|FLJ42910|KIAA0400|PAG3|PAP|Pap-alpha|SHAG1
Gene Description ArfGAP with SH3 domain, ankyrin repeat and PH domain 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq RGPVDLSATEALGPLSNAMVLQPPAPMPRKSQATKLKPKRVKALYNCVADNPDELTFSEGDVIIVDGEEDQEWWIGHIDGDPGRKGAFPVSFVHFIAD
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen DDEF2 (NP_003878, 909 a.a. ~ 1006 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 8853

Enviar un mensaje


DDEF2 polyclonal antibody (A01)

DDEF2 polyclonal antibody (A01)