CDK5R1 monoclonal antibody (M01), clone 4G11
  • CDK5R1 monoclonal antibody (M01), clone 4G11

CDK5R1 monoclonal antibody (M01), clone 4G11

Ref: AB-H00008851-M01
CDK5R1 monoclonal antibody (M01), clone 4G11

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CDK5R1.
Información adicional
Size 100 ug
Gene Name CDK5R1
Gene Alias CDK5P35|CDK5R|MGC33831|NCK5A|p23|p25|p35|p35nck5a
Gene Description cyclin-dependent kinase 5, regulatory subunit 1 (p35)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq CRDVISSEVGSDHELQAVLLTCLYLSYSYMGNEISYPLKPFLVESCKEAFWDRCLSVINLMSSKMLQINADPHYFTQVFSDLKNESGQEDKKRLLLGLDR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CDK5R1 (AAH20580, 208 a.a. ~ 307 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8851
Clone Number 4G11
Iso type IgG2a Kappa

Enviar un mensaje


CDK5R1 monoclonal antibody (M01), clone 4G11

CDK5R1 monoclonal antibody (M01), clone 4G11