TSC22D1 monoclonal antibody (M02), clone 1F5
  • TSC22D1 monoclonal antibody (M02), clone 1F5

TSC22D1 monoclonal antibody (M02), clone 1F5

Ref: AB-H00008848-M02
TSC22D1 monoclonal antibody (M02), clone 1F5

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant TSC22D1.
Información adicional
Size 100 ug
Gene Name TSC22D1
Gene Alias DKFZp686O19206|MGC17597|RP11-269C23.2|TGFB1I4|TSC22
Gene Description TSC22 domain family, member 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MKSQWCRPVAMDLGVYQLRHFSISFLSSLLGTENASVRLDNSSSGASVVAIDNKIEQAMDLVKSHLMYAVREEVEVLKEQIKELIEKNSQLEQENNLLKTLASPEQLAQFQAQLQTGSPPATTQPQGTTQPPAQPASQGSGPTA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TSC22D1 (AAH00456, 1 a.a. ~ 144 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8848
Clone Number 1F5
Iso type IgG1 Kappa

Enviar un mensaje


TSC22D1 monoclonal antibody (M02), clone 1F5

TSC22D1 monoclonal antibody (M02), clone 1F5