ALKBH1 purified MaxPab mouse polyclonal antibody (B01P)
  • ALKBH1 purified MaxPab mouse polyclonal antibody (B01P)

ALKBH1 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00008846-B01P
ALKBH1 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human ALKBH1 protein.
Información adicional
Size 50 ug
Gene Name ALKBH1
Gene Alias ABH|ABH1|ALKBH|alkB|hABH
Gene Description alkB, alkylation repair homolog 1 (E. coli)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P,IF
Immunogen Prot. Seq MGKMAAAVGSVATLATEPGEDAFRKLFRFYRQSRPGTADLEGVIDFSAAHAARGKGPGAQKVIKSQLNVSSVSEQNAYRAGLQPVSKWQAYGLKGYPGFIFIPNPFLPGYQWHWVKQCLKLYSQKPNVCNLDKHMSKEETQDLWEQSKEFLRYKEATKRRPRSLLEKLRWVTVGYHYNWDSKKYSADHYTPFPSDLGFLSEQVAAACGFEDFRAEAGILNYYRLDSTLGIHVDRSELDHSKPLLSFSFGQSAIFL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ALKBH1 (AAH25787.1, 1 a.a. ~ 389 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8846

Enviar un mensaje


ALKBH1 purified MaxPab mouse polyclonal antibody (B01P)

ALKBH1 purified MaxPab mouse polyclonal antibody (B01P)