KSR monoclonal antibody (M01), clone 6C7
  • KSR monoclonal antibody (M01), clone 6C7

KSR monoclonal antibody (M01), clone 6C7

Ref: AB-H00008844-M01
KSR monoclonal antibody (M01), clone 6C7

Información del producto

Mouse monoclonal antibody raised against a partial recombinant KSR.
Información adicional
Size 100 ug
Gene Name KSR1
Gene Alias KSR|RSU2
Gene Description kinase suppressor of ras 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq LDARRESGSGPSTDTLSAASLPWPPGSSQLGRAGNSAQGPRSISVSALPASDSPTPSFSEGLSDTCIPLHASGRLTPRALHSFITPPTTPQLRRHTKLKP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen KSR (XP_290793, 301 a.a. ~ 400 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8844
Clone Number 6C7
Iso type IgG2a Kappa

Enviar un mensaje


KSR monoclonal antibody (M01), clone 6C7

KSR monoclonal antibody (M01), clone 6C7