SOCS2 polyclonal antibody (A01)
  • SOCS2 polyclonal antibody (A01)

SOCS2 polyclonal antibody (A01)

Ref: AB-H00008835-A01
SOCS2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant SOCS2.
Información adicional
Size 50 uL
Gene Name SOCS2
Gene Alias CIS2|Cish2|SOCS-2|SSI-2|SSI2|STATI2
Gene Description suppressor of cytokine signaling 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq YQDGKFRLDSIICVKSKLKQFDSVVHLIDYYVQMCKDKRTGPEAPRNGTVHLYLTKPLYTSAPSLQHLCRLTINKCTGAIWGLPLPTRLKDYLEEYKFQV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SOCS2 (AAH10399, 99 a.a. ~ 198 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 8835

Enviar un mensaje


SOCS2 polyclonal antibody (A01)

SOCS2 polyclonal antibody (A01)