C17orf35 polyclonal antibody (A01)
  • C17orf35 polyclonal antibody (A01)

C17orf35 polyclonal antibody (A01)

Ref: AB-H00008834-A01
C17orf35 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant C17orf35.
Información adicional
Size 50 uL
Gene Name TMEM11
Gene Alias C17orf35|PM1|PMI
Gene Description transmembrane protein 11
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq FDPCCKYQVEYDAYKLSRLPLHTLTSSTPVVLVRKDDLHRKRLHNTIALAALVYCVKKIYELYAV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen C17orf35 (NP_003867, 128 a.a. ~ 192 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 8834

Enviar un mensaje


C17orf35 polyclonal antibody (A01)

C17orf35 polyclonal antibody (A01)