GMPS purified MaxPab rabbit polyclonal antibody (D01P)
  • GMPS purified MaxPab rabbit polyclonal antibody (D01P)

GMPS purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00008833-D01P
GMPS purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human GMPS protein.
Información adicional
Size 100 ug
Gene Name GMPS
Gene Alias -
Gene Description guanine monphosphate synthetase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MALCNGDSKLENAGGDLKDGHHHYEGAVVILDAGAQYGKVIDRRVRELFVQSEIFPLETPAFAIKEQGFRAIIISGGPNSVYAEDAPWFDPAIFTIGKPVLGICYGMQMMNKVFGGTVHKKSVREDGVFNISVDNTCSLFRGLQKEEVVLLTHGDSVDKVADGFKVVARSGNIVAGIANESKKLYGAQFHPEVGLTENGKVILKNFLYDIAGCSGTFTVQNRELECIREIKERVGTSKVLVLLSGGVDSTVCTAL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen GMPS (NP_003866.1, 1 a.a. ~ 693 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8833

Enviar un mensaje


GMPS purified MaxPab rabbit polyclonal antibody (D01P)

GMPS purified MaxPab rabbit polyclonal antibody (D01P)