GMPS polyclonal antibody (A01)
  • GMPS polyclonal antibody (A01)

GMPS polyclonal antibody (A01)

Ref: AB-H00008833-A01
GMPS polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant GMPS.
Información adicional
Size 50 uL
Gene Name GMPS
Gene Alias -
Gene Description guanine monphosphate synthetase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq QMMNKVFGGTVHKKSVREDGVFNISVDNTCSLFRGLQKEEVVLLTHGDSVDKVADGFKVVARSGNIVAGIANESKKLYGAQFHPEVGLTENGKVILKNFLYDIAGCSG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GMPS (NP_003866, 108 a.a. ~ 215 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 8833

Enviar un mensaje


GMPS polyclonal antibody (A01)

GMPS polyclonal antibody (A01)