NRP2 monoclonal antibody (M01), clone 3B8
  • NRP2 monoclonal antibody (M01), clone 3B8

NRP2 monoclonal antibody (M01), clone 3B8

Ref: AB-H00008828-M01
NRP2 monoclonal antibody (M01), clone 3B8

Información del producto

Mouse monoclonal antibody raised against a partial recombinant NRP2.
Información adicional
Size 100 ug
Gene Name NRP2
Gene Alias MGC126574|NP2|NPN2|PRO2714|VEGF165R2
Gene Description neuropilin 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq EEATECGENCSFEDDKDLQLPSGFNCNFDFLEEPCGWMYDHAKWLRTTWASSSSPNDRTFPDDRNFLRLQSDSQREGQYARLISPPVHLPRSPVC
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NRP2 (NP_958436, 621 a.a. ~ 715 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8828
Clone Number 3B8
Iso type IgG1 Kappa

Enviar un mensaje


NRP2 monoclonal antibody (M01), clone 3B8

NRP2 monoclonal antibody (M01), clone 3B8