NRP2 polyclonal antibody (A01)
  • NRP2 polyclonal antibody (A01)

NRP2 polyclonal antibody (A01)

Ref: AB-H00008828-A01
NRP2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant NRP2.
Información adicional
Size 50 uL
Gene Name NRP2
Gene Alias MGC126574|NP2|NPN2|PRO2714|VEGF165R2
Gene Description neuropilin 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq EEATECGENCSFEDDKDLQLPSGFNCNFDFLEEPCGWMYDHAKWLRTTWASSSSPNDRTFPDDRNFLRLQSDSQREGQYARLISPPVHLPRSPVC
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NRP2 (NP_958436, 621 a.a. ~ 715 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 8828

Enviar un mensaje


NRP2 polyclonal antibody (A01)

NRP2 polyclonal antibody (A01)