IQGAP1 monoclonal antibody (M01), clone 2C5
  • IQGAP1 monoclonal antibody (M01), clone 2C5

IQGAP1 monoclonal antibody (M01), clone 2C5

Ref: AB-H00008826-M01
IQGAP1 monoclonal antibody (M01), clone 2C5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant IQGAP1.
Información adicional
Size 100 ug
Gene Name IQGAP1
Gene Alias HUMORFA01|KIAA0051|SAR1|p195
Gene Description IQ motif containing GTPase activating protein 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,IHC-P,S-ELISA,ELISA,IF
Immunogen Prot. Seq WQSNKDTQEAQKFALGIFAINEAVESGDVGKTLSALRSPDVGLYGVIPECGETYHSDLAEAKKKKLAVGDNNSKWVKHWVKGGYYYYHNLETQEGGWDEP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen IQGAP1 (NP_003861, 611 a.a. ~ 710 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8826
Clone Number 2C5
Iso type IgG1 kappa

Enviar un mensaje


IQGAP1 monoclonal antibody (M01), clone 2C5

IQGAP1 monoclonal antibody (M01), clone 2C5