CES2 monoclonal antibody (M01A), clone 2H7
  • CES2 monoclonal antibody (M01A), clone 2H7

CES2 monoclonal antibody (M01A), clone 2H7

Ref: AB-H00008824-M01A
CES2 monoclonal antibody (M01A), clone 2H7

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CES2.
Información adicional
Size 200 uL
Gene Name CES2
Gene Alias CE-2|CES2A1|PCE-2|iCE
Gene Description carboxylesterase 2 (intestine, liver)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq PPHMKADHGDELPFVFRSFFGGNYIKFTEEEEQLSRKMMKYWANFARNGNPNGEGLPHWPLFDQEEQYLQLNLQPAVGRALKAHRLQFWKKALPQKIQELEEPEERHT
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CES2 (NP_003860, 514 a.a. ~ 621 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In ascites fluid
Gene ID 8824
Clone Number 2H7
Iso type IgG2b Kappa

Enviar un mensaje


CES2 monoclonal antibody (M01A), clone 2H7

CES2 monoclonal antibody (M01A), clone 2H7