CES2 purified MaxPab mouse polyclonal antibody (B01P)
  • CES2 purified MaxPab mouse polyclonal antibody (B01P)

CES2 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00008824-B01P
CES2 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human CES2 protein.
Información adicional
Size 50 ug
Gene Name CES2
Gene Alias CE-2|CES2A1|PCE-2|iCE
Gene Description carboxylesterase 2 (intestine, liver)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MTAQSRSPTTPTFPGPSQRTPLTPCPVQTPRLGKALIHCWTDPGQPLGEQQRVRRQRTETSEPTMRLHRLRARLSAVACGLLLLLVRGQGQDSASPIRTTHTGQVLGSLVHVKGANAGVQTFLGIPFAKPPLGPLRFAPPEPPESWSGVRDGTTHPAMCLQDLTAVESEFLSQFNMTFPSDSMSEDCLYLSIYTPAHSHEGSNLPVMVWIHGGALVFGMASLYDGSMLAALENVVVVIIQYRLGVLGFFSTGDKH
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CES2 (NP_003860.2, 1 a.a. ~ 623 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8824

Enviar un mensaje


CES2 purified MaxPab mouse polyclonal antibody (B01P)

CES2 purified MaxPab mouse polyclonal antibody (B01P)