IL18RAP monoclonal antibody (M04), clone 4G4
  • IL18RAP monoclonal antibody (M04), clone 4G4

IL18RAP monoclonal antibody (M04), clone 4G4

Ref: AB-H00008807-M04
IL18RAP monoclonal antibody (M04), clone 4G4

Información del producto

Mouse monoclonal antibody raised against a partial recombinant IL18RAP.
Información adicional
Size 100 ug
Gene Name IL18RAP
Gene Alias ACPL|CD218b|CDw218b|IL18RB|MGC120589|MGC120590
Gene Description interleukin 18 receptor accessory protein
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq FNISGCSTKKLLWTYSTRSEEEFVLFCDLPEPQKSHFCHRNRLSPKQVPEHLPFMGSNDLSDVQWYQQPSNGDPLEDIRKSYPHIIQDKCTLHFLTPGVNNSGSYICRPK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen IL18RAP (NP_003844, 20 a.a. ~ 129 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8807
Clone Number 4G4
Iso type IgG2a Kappa

Enviar un mensaje


IL18RAP monoclonal antibody (M04), clone 4G4

IL18RAP monoclonal antibody (M04), clone 4G4