TNFRSF10A monoclonal antibody (M02), clone 2E9
  • TNFRSF10A monoclonal antibody (M02), clone 2E9

TNFRSF10A monoclonal antibody (M02), clone 2E9

Ref: AB-H00008797-M02
TNFRSF10A monoclonal antibody (M02), clone 2E9

Información del producto

Mouse monoclonal antibody raised against a partial recombinant TNFRSF10A.
Información adicional
Size 100 ug
Gene Name TNFRSF10A
Gene Alias APO2|CD261|DR4|MGC9365|TRAILR-1|TRAILR1
Gene Description tumor necrosis factor receptor superfamily, member 10a
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq PSSAATIKLHDQSIGTQQWEHSPLGELCPPGSHRSERPGACNRCTEGVGYTNASNNLFACLPCTACKSDEEERSPCTTTRNTACQCKPGTFRNDNSAEMC
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TNFRSF10A (AAH12866, 105 a.a. ~ 204 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8797
Clone Number 2E9
Iso type IgG1 Kappa

Enviar un mensaje


TNFRSF10A monoclonal antibody (M02), clone 2E9

TNFRSF10A monoclonal antibody (M02), clone 2E9